Recombinant Human ADAT2 Protein, GST-tagged

• Cat.No.: ADAT2-2507H
• Product Overview: Human DEADC1 full-length ORF ( ENSP00000356566, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ADAT2 (Adenosine Deaminase, TRNA Specific 2) is a Protein Coding gene. Among its related pathways are Gene Expression and tRNA processing. GO annotations related to this gene include hydrolase activity and tRNA-specific adenosine deaminase activity.
• Molecular Mass: 42.5 kDa
• AA Sequence: MVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAT2 adenosine deaminase, tRNA-specific 2 [ Homo sapiens ]
• Official Symbol: ADAT2
• Synonyms: ADAT2; adenosine deaminase, tRNA-specific 2; adenosine deaminase, tRNA specific 2, TAD2 homolog (S. cerevisiae) , DEADC1, deaminase domain containing 1; tRNA-specific adenosine deaminase 2; dJ20N2.1; TAD2; tRNA specific adenosine deaminase 2 homolog (S. cerevisiae); deaminase domain containing 1; deaminase domain-containing protein 1; tRNA-specific adenosine deaminase 2 homolog; adenosine deaminase, tRNA-specific 2, TAD2 homolog; tRNA-specific adenosine-34 deaminase subunit ADAT2; DEADC1; dJ20N2
• Gene ID: 134637
• mRNA Refseq: NM_182503
• Protein Refseq: NP_872309
• MIM: 615388
• UniProt ID: Q7Z6V5