Recombinant Full Length Human ADGRF1 Protein, GST-tagged

Cat.No. : ADGRF1-5567HF
Product Overview : Human GPR110 full-length ORF ( NP_079324.2, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 218 amino acids
Description : ADGRF1 (Adhesion G Protein-Coupled Receptor F1) is a Protein Coding gene. GO annotations related to this gene include G-protein coupled receptor activity and transmembrane signaling receptor activity. An important paralog of this gene is ADGRF5.
Molecular Mass : 51.3 kDa
AA Sequence : MKVGVLWLISFFTFTDGHGGFLGKNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSKEKRDLRNFLKLLKPPLLWSHGLIRIIRAKATTDCNSLNGVLQCTCEDSYTWFPPSCLDPQNCYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANGIEIQLKKAYERIQGFESVQVTQFRMSLLSPKLECNGTI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADGRF1 adhesion G protein-coupled receptor F1 [ Homo sapiens (human) ]
Official Symbol ADGRF1
Synonyms GPR110; G protein-coupled receptor 110; probable G-protein coupled receptor 110; hGPCR36; PGR19; G-protein coupled receptor 110; G protein-coupled receptor PGR19; G-protein coupled receptor PGR19; G-protein coupled receptor KPG_012; seven transmembrane helix receptor; KPG_012; FLJ22684; FLJ30646; MGC125952;
Gene ID 266977
mRNA Refseq NM_025048
Protein Refseq NP_079324
MIM 617430
UniProt ID Q5T601

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADGRF1 Products

Required fields are marked with *

My Review for All ADGRF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon