Recombinant Full Length Human AHNAK Protein, C-Flag-tagged

Cat.No. : AHNAK-1296HFL
Product Overview : Recombinant Full Length Human AHNAK Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene is a large (700 kDa) structural scaffold protein consisting of a central domain with 128 aa repeats. The encoded protein may play a role in such diverse processes as blood-brain barrier formation, cell structure and migration, cardiac calcium channel regulation, and tumor metastasis. A much shorter variant encoding a 17 kDa isoform exists for this gene, and the shorter isoform initiates a feedback loop that regulates alternative splicing of this gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 15.9 kDa
AA Sequence : MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEV TQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTREVFSSCSSEVFLNTPQPSALECKDQNKQKEASSQAGAV
SVSTPNAGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Protease
Full Length : Full L.
Gene Name AHNAK AHNAK nucleoprotein [ Homo sapiens (human) ]
Official Symbol AHNAK
Synonyms PM227; AHNAK1; AHNAKRS
Gene ID 79026
mRNA Refseq NM_024060.4
Protein Refseq NP_076965.2
MIM 103390
UniProt ID Q9BVU3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AHNAK Products

Required fields are marked with *

My Review for All AHNAK Products

Required fields are marked with *

0
cart-icon
0
compare icon