Recombinant Full Length Human AIDA Protein, GST-tagged
Cat.No. : | AIDA-4857HF |
Product Overview : | Human FLJ12806 full-length ORF ( AAH15535, 1 a.a. - 306 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 306 amino acids |
Description : | AIDA (Axin Interactor, Dorsalization Associated) is a Protein Coding gene. GO annotations related to this gene include protein domain specific binding. |
Molecular Mass : | 59.4 kDa |
AA Sequence : | MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AIDA axin interactor, dorsalization associated [ Homo sapiens ] |
Official Symbol | AIDA |
Synonyms | AIDA; axin interactor, dorsalization associated; C1orf80, chromosome 1 open reading frame 80; axin interactor, dorsalization-associated protein; axin interaction partner and dorsalization antagonist; FLJ12806; C1orf80; FLJ32421; RP11-378J18.7; |
Gene ID | 64853 |
mRNA Refseq | NM_022831 |
Protein Refseq | NP_073742 |
MIM | 612375 |
UniProt ID | Q96BJ3 |
◆ Recombinant Proteins | ||
AIDA-4240H | Recombinant Human AIDA Protein, GST-tagged | +Inquiry |
AIDA-1448M | Recombinant Mouse AIDA Protein | +Inquiry |
AIDA-4857HF | Recombinant Full Length Human AIDA Protein, GST-tagged | +Inquiry |
AIDA-410M | Recombinant Mouse AIDA Protein, His (Fc)-Avi-tagged | +Inquiry |
AIDA-286C | Recombinant Cynomolgus AIDA Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIDA-8957HCL | Recombinant Human AIDA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AIDA Products
Required fields are marked with *
My Review for All AIDA Products
Required fields are marked with *