Recombinant Full Length Human AIDA Protein, GST-tagged

Cat.No. : AIDA-4857HF
Product Overview : Human FLJ12806 full-length ORF ( AAH15535, 1 a.a. - 306 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 306 amino acids
Description : AIDA (Axin Interactor, Dorsalization Associated) is a Protein Coding gene. GO annotations related to this gene include protein domain specific binding.
Molecular Mass : 59.4 kDa
AA Sequence : MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AIDA axin interactor, dorsalization associated [ Homo sapiens ]
Official Symbol AIDA
Synonyms AIDA; axin interactor, dorsalization associated; C1orf80, chromosome 1 open reading frame 80; axin interactor, dorsalization-associated protein; axin interaction partner and dorsalization antagonist; FLJ12806; C1orf80; FLJ32421; RP11-378J18.7;
Gene ID 64853
mRNA Refseq NM_022831
Protein Refseq NP_073742
MIM 612375
UniProt ID Q96BJ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AIDA Products

Required fields are marked with *

My Review for All AIDA Products

Required fields are marked with *

0
cart-icon
0
compare icon