Recombinant Full Length Human AIF1L Protein, GST-tagged
Cat.No. : | AIF1L-2582HF |
Product Overview : | Human C9orf58 full-length ORF (NP_113614.1, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 150 amino acids |
Description : | AIF1L (Allograft Inflammatory Factor 1 Like) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding and actin filament binding. An important paralog of this gene is AIF1. |
Molecular Mass : | 43.5 kDa |
AA Sequence : | MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AIF1L allograft inflammatory factor 1-like [ Homo sapiens ] |
Official Symbol | AIF1L |
Synonyms | AIF1L; allograft inflammatory factor 1-like; C9orf58, chromosome 9 open reading frame 58; FLJ12783; IBA2; ionized calcium binding adapter molecule 2; ionized calcium-binding adapter molecule 2; C9orf58; MGC29466; |
Gene ID | 83543 |
mRNA Refseq | NM_001185095 |
Protein Refseq | NP_001172024 |
UniProt ID | Q9BQI0 |
◆ Recombinant Proteins | ||
ANP32B-340R | Recombinant Rat ANP32B Protein, His (Fc)-Avi-tagged | +Inquiry |
AIF1L-2582HF | Recombinant Full Length Human AIF1L Protein, GST-tagged | +Inquiry |
ANP32B-9686H | Recombinant Human ANP32B, GST-tagged | +Inquiry |
AIF1L-3887H | Recombinant Human AIF1L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ANP32B-1704M | Recombinant Mouse ANP32B Protein | +Inquiry |
◆ Native Proteins | ||
ANP32B-01HFL | Recombinant Full Length Human ANP32B Protein, GST&His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANP32B-8842HCL | Recombinant Human ANP32B 293 Cell Lysate | +Inquiry |
AIF1L-8955HCL | Recombinant Human AIF1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANP32B Products
Required fields are marked with *
My Review for All ANP32B Products
Required fields are marked with *
0
Inquiry Basket