Recombinant Full Length Human AIRE Protein, C-Flag-tagged
Cat.No. : | AIRE-1123HFL |
Product Overview : | Recombinant Full Length Human AIRE Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a transcriptional regulator that forms nuclear bodies and interacts with the transcriptional coactivator CREB binding protein. The encoded protein plays an important role in immunity by regulating the expression of autoantigens and negative selection of autoreactive T-cells in the thymus. Mutations in this gene cause the rare autosomal-recessive systemic autoimmune disease termed autoimmune polyendocrinopathy with candidiasis and ectodermal dystrophy (APECED). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.5 kDa |
AA Sequence : | MATDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALLSWLLTQD STAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQPRKGRKPPAVPKALVPPPRLPTKRKASEEARA AAPAALTPRGTASPGSQLKAKPPKKPESSAEQQRLPLGNGIQTMSASVQRAVAMSSGDVPGARGAVEGIL IQQVFESGGSKKCIQVGGEFYTPSKFEDSGSGKNKARSSSGPKPLVRAKGAQGAAPGGGEARLGQQGSVP APLALPSDPQLHQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQP RAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCV GPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAP SPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Primary immunodeficiency, Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | AIRE autoimmune regulator [ Homo sapiens (human) ] |
Official Symbol | AIRE |
Synonyms | APS1; APSI; PGA1; AIRE1; APECED |
Gene ID | 326 |
mRNA Refseq | NM_000383.4 |
Protein Refseq | NP_000374.1 |
MIM | 607358 |
UniProt ID | O43918 |
◆ Recombinant Proteins | ||
Aire-560M | Recombinant Mouse Aire Protein, MYC/DDK-tagged | +Inquiry |
AIRE-299H | Recombinant Human AIRE Protein, His (Fc)-Avi-tagged | +Inquiry |
AIRE-6087Z | Recombinant Zebrafish AIRE | +Inquiry |
AIRE-1123HFL | Recombinant Full Length Human AIRE Protein, C-Flag-tagged | +Inquiry |
AIRE-3784H | Recombinant Human AIRE, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AIRE Products
Required fields are marked with *
My Review for All AIRE Products
Required fields are marked with *
0
Inquiry Basket