Recombinant Full Length Human AK9 Protein, GST-tagged
| Cat.No. : | AK9-2700HF |
| Product Overview : | Human AK9 full-length ORF (AAH22031, 1 a.a. - 421 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 421 amino acids |
| Description : | The protein encoded by this gene catalyzes the interconversion of nucleosides, possessing both nucleoside monophosphate and diphosphate kinase activities. The encoded protein uses these interconversions to maintain nucleoside homeostasis. [provided by RefSeq, Jul 2016] |
| Molecular Mass : | 72.05 kDa |
| AA Sequence : | MTSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYITQAWKCIRVEALPILEEQIAAETESGVMLQSMLISGQSIPDELVIKLMLEKLNSPEVCHFGYIITEIPSLSQDAMTTLQQIELIKNLNLKPDVIINIKCPDYDLCQRISGQRQHNNTGYIYSRDQWDPEVIENHRKKKKEAQKDGKGEEEEEEEEQEEEEAFIAEMQMVAEILHHLVQRPEDYLENVENIVKLYKETILQTLEEVMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKLQGAEEEINDTMENDELFRTLASYKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVTN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AK9 adenylate kinase 9 [ Homo sapiens (human) ] |
| Official Symbol | AK9 |
| Synonyms | AK9; adenylate kinase 9; C6ORF199; chromosome 6 open reading frame 199; MGC26954; dJ70A9.1; adenylate kinase 9; adenylate kinase domain containing 1; adenylate kinase domain containing 2; EC 2.7.4.4; EC 2.7.4.6 |
| Gene ID | 221264 |
| mRNA Refseq | NM_001145128 |
| Protein Refseq | NP_001138600 |
| MIM | 615358 |
| UniProt ID | Q5TCS8 |
| ◆ Recombinant Proteins | ||
| AK9-33HFL | Recombinant Full Length Human AK9 Protein, Flag tagged | +Inquiry |
| AK9-118H | Recombinant Human AK9 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AK9-2700HF | Recombinant Full Length Human AK9 Protein, GST-tagged | +Inquiry |
| AK9-0114H | Recombinant Human AK9 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AK9-125HCL | Recombinant Human AK9 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AK9 Products
Required fields are marked with *
My Review for All AK9 Products
Required fields are marked with *
