Recombinant Human AK9 Protein, GST-Tagged

Cat.No. : AK9-0114H
Product Overview : Human AK9 full-length ORF (AAH22031, 1 a.a. - 421 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene catalyzes the interconversion of nucleosides, possessing both nucleoside monophosphate and diphosphate kinase activities. The encoded protein uses these interconversions to maintain nucleoside homeostasis. [provided by RefSeq, Jul 2016]
Molecular Mass : 72.05 kDa
AA Sequence : MTSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYITQAWKCIRVEALPILEEQIAAETESGVMLQSMLISGQSIPDELVIKLMLEKLNSPEVCHFGYIITEIPSLSQDAMTTLQQIELIKNLNLKPDVIINIKCPDYDLCQRISGQRQHNNTGYIYSRDQWDPEVIENHRKKKKEAQKDGKGEEEEEEEEQEEEEAFIAEMQMVAEILHHLVQRPEDYLENVENIVKLYKETILQTLEEVMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKLQGAEEEINDTMENDELFRTLASYKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVTN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AK9 adenylate kinase 9 [ Homo sapiens (human) ]
Official Symbol AK9
Synonyms AK9; adenylate kinase 9; C6ORF199; chromosome 6 open reading frame 199; MGC26954; dJ70A9.1; adenylate kinase 9; adenylate kinase domain containing 1; adenylate kinase domain containing 2; EC 2.7.4.4; EC 2.7.4.6
Gene ID 221264
mRNA Refseq NM_001145128
Protein Refseq NP_001138600
MIM 615358
UniProt ID Q5TCS8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AK9 Products

Required fields are marked with *

My Review for All AK9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon