Recombinant Full Length Human AKIRIN2 Protein, GST-tagged
Cat.No. : | AKIRIN2-2584HF |
Product Overview : | Human C6orf166 full-length ORF (AAH00764, 1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 203 amino acids |
Description : | AKIRIN2 (Akirin 2) is a Protein Coding gene. GO annotations related to this gene include enzyme binding. An important paralog of this gene is AKIRIN1. |
Molecular Mass : | 48.07 kDa |
AA Sequence : | MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AKIRIN2 akirin 2 [ Homo sapiens ] |
Official Symbol | AKIRIN2 |
Synonyms | AKIRIN2; akirin 2; C6orf166, chromosome 6 open reading frame 166; akirin-2; dJ486L4.2; FLJ10342; fourteen-three-three beta interactant 1; FBI1; C6orf166; |
Gene ID | 55122 |
mRNA Refseq | NM_018064 |
Protein Refseq | NP_060534 |
MIM | 615165 |
UniProt ID | Q53H80 |
◆ Recombinant Proteins | ||
AKIRIN2-1486M | Recombinant Mouse AKIRIN2 Protein | +Inquiry |
AKIRIN2-250R | Recombinant Rat AKIRIN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKIRIN2-302H | Recombinant Human AKIRIN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKIRIN2-3643H | Recombinant Human AKIRIN2 protein, GST-tagged | +Inquiry |
AKIRIN2-0011H | Recombinant Human AKIRIN2 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKIRIN2-8934HCL | Recombinant Human AKIRIN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKIRIN2 Products
Required fields are marked with *
My Review for All AKIRIN2 Products
Required fields are marked with *