Recombinant Full Length Human ALKBH1 Protein, C-Flag-tagged
Cat.No. : | ALKBH1-223HFL |
Product Overview : | Recombinant Full Length Human ALKBH1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 43.7 kDa |
AA Sequence : | MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVS SVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEET QDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFE DFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSG FSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATD QNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ALKBH1 alkB homolog 1, histone H2A dioxygenase [ Homo sapiens (human) ] |
Official Symbol | ALKBH1 |
Synonyms | ABH; ABH1; alkB; hABH; ALKBH |
Gene ID | 8846 |
mRNA Refseq | NM_006020.3 |
Protein Refseq | NP_006011.2 |
MIM | 605345 |
UniProt ID | Q13686 |
◆ Recombinant Proteins | ||
ALKBH1-319H | Recombinant Human ALKBH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALKBH1-2853Z | Recombinant Zebrafish ALKBH1 | +Inquiry |
ALKBH1-474H | Recombinant Human ALKBH1 Protein, GST-tagged | +Inquiry |
ALKBH1-1198H | Recombinant Human ALKBH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Alkbh1-1599M | Recombinant Mouse Alkbh1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALKBH1-8903HCL | Recombinant Human ALKBH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALKBH1 Products
Required fields are marked with *
My Review for All ALKBH1 Products
Required fields are marked with *
0
Inquiry Basket