Recombinant Full Length Human ALKBH3 Protein, GST-tagged

• Cat.No.: ALKBH3-2470HF
• Product Overview: Human DEPC-1 full-length ORF ( AAH15155, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 139 amino acids
• Description: The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 41.03 kDa
• AA Sequence: MEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ALKBH3 alkB, alkylation repair homolog 3 (E. coli) [ Homo sapiens ]
• Official Symbol: ALKBH3
• Synonyms: ALKBH3; alkB, alkylation repair homolog 3 (E. coli); alpha-ketoglutarate-dependent dioxygenase alkB homolog 3; DEPC 1; prostate cancer antigen 1; prostate cancer antigen-1; alkylated DNA repair protein alkB homolog 3; ABH3; PCA1; DEPC1; DEPC-1; FLJ43614; MGC118790; MGC118792; MGC118793
• Gene ID: 221120
• mRNA Refseq: NM_139178
• Protein Refseq: NP_631917
• MIM: 610603
• UniProt ID: Q96Q83