Recombinant Full Length Human ALX1 Protein, GST-tagged

Cat.No. : ALX1-2596HF
Product Overview : Human CART1 full-length ORF (AAH10923.1, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 326 amino acids
Description : The specific function of this gene has yet to be determined in humans; however, in rodents, it is necessary for survival of the forebrain mesenchyme and may also be involved in development of the cervix. Mutations in the mouse gene lead to neural tube defects such as acrania and meroanencephaly. [provided by RefSeq, Jul 2008]
Molecular Mass : 63.4 kDa
AA Sequence : MEFLSEKFALKSPPSKNSDFYMGAGGPLEHVMETLDNESFYSKASAGKCVQAFGPLPRAEHHVRLERTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSSSIAVLRMKAKEHTANISWAM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ALX1 ALX homeobox 1 [ Homo sapiens ]
Official Symbol ALX1
Synonyms ALX1; ALX homeobox 1; CART1, cartilage paired class homeoprotein 1; ALX homeobox protein 1; CART-1; cartilage paired-class homeoprotein 1; FND3; CART1;
Gene ID 8092
mRNA Refseq NM_006982
Protein Refseq NP_008913
MIM 601527
UniProt ID Q15699

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALX1 Products

Required fields are marked with *

My Review for All ALX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon