Recombinant Full Length Human Androgen-Induced Gene 1 Protein(Aig1) Protein, His-Tagged
| Cat.No. : | RFL27585HF |
| Product Overview : | Recombinant Full Length Human Androgen-induced gene 1 protein(AIG1) Protein (Q9NVV5) (1-245aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-245) |
| Form : | Lyophilized powder |
| AA Sequence : | MALVPCQVLRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLT DLSSLLTRGSGNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKL LDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVT GMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQKKPPSWQDMKIKFMY LGPSS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | AIG1 |
| Synonyms | A2LD1; AIG 1; AIG-1; AIG1; AIG1_HUMAN; Androgen induced 1; Androgen induced protein (AIG-1); Androgen induced protein (AIG-1); C-terminus truncated; Androgen-induced gene 1 protein; dJ95L4.1; DKFZp686F03136; FLJ10485; GGACT; RP1 95L4.1 |
| UniProt ID | Q9NVV5 |
| ◆ Recombinant Proteins | ||
| AIG1-280R | Recombinant Rhesus monkey AIG1 Protein, His-tagged | +Inquiry |
| AIG1-108R | Recombinant Rhesus Macaque AIG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AIG1-1454M | Recombinant Mouse AIG1 Protein | +Inquiry |
| RFL12283MF | Recombinant Full Length Mouse Androgen-Induced Gene 1 Protein(Aig1) Protein, His-Tagged | +Inquiry |
| AIG1-9506H | Recombinant Human AIG1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AIG1 Products
Required fields are marked with *
My Review for All AIG1 Products
Required fields are marked with *
