Recombinant Full Length Human ANO10 Protein, GST-tagged

Cat.No. : ANO10-4838HF
Product Overview : Human FLJ10375 full-length ORF ( AAH38855, 1 a.a. - 392 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 392 amino acids
Description : The transmembrane protein encoded by this gene belongs to the anoctamin family of calcium-activated chloride channels, also known as the transmembrane 16 family. The encoded protein contains eight transmembrane domains with cytosolic N- and C-termini. Defects in this gene may cause autosomal recessive spinocerebellar ataxia-10. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016]
Molecular Mass : 68.86 kDa
AA Sequence : MLLGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRRLLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIENHRLESAYQNHLILKVLVFNFLNCFASLFYIAFVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFSEPSANIGVWQLAFEMMSVISVVTNCALIGMSPQVNAAFPESKADLILIVVAVEHALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQMKLVTENLKEEPMESGKEKAT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANO10 anoctamin 10 [ Homo sapiens ]
Official Symbol ANO10
Synonyms ANO10; anoctamin 10; TMEM16K, transmembrane protein 16K; anoctamin-10; FLJ10375; MGC47890; SCAR10; transmembrane protein 16K; TMEM16K;
Gene ID 55129
mRNA Refseq NM_001204831
Protein Refseq NP_001191760
MIM 613726
UniProt ID Q9NW15

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANO10 Products

Required fields are marked with *

My Review for All ANO10 Products

Required fields are marked with *

0
cart-icon