Recombinant Full Length Human ANO10 Protein, GST-tagged
Cat.No. : | ANO10-4838HF |
Product Overview : | Human FLJ10375 full-length ORF ( AAH38855, 1 a.a. - 392 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 392 amino acids |
Description : | The transmembrane protein encoded by this gene belongs to the anoctamin family of calcium-activated chloride channels, also known as the transmembrane 16 family. The encoded protein contains eight transmembrane domains with cytosolic N- and C-termini. Defects in this gene may cause autosomal recessive spinocerebellar ataxia-10. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016] |
Molecular Mass : | 68.86 kDa |
AA Sequence : | MLLGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRRLLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIENHRLESAYQNHLILKVLVFNFLNCFASLFYIAFVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFSEPSANIGVWQLAFEMMSVISVVTNCALIGMSPQVNAAFPESKADLILIVVAVEHALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQMKLVTENLKEEPMESGKEKAT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANO10 anoctamin 10 [ Homo sapiens ] |
Official Symbol | ANO10 |
Synonyms | ANO10; anoctamin 10; TMEM16K, transmembrane protein 16K; anoctamin-10; FLJ10375; MGC47890; SCAR10; transmembrane protein 16K; TMEM16K; |
Gene ID | 55129 |
mRNA Refseq | NM_001204831 |
Protein Refseq | NP_001191760 |
MIM | 613726 |
UniProt ID | Q9NW15 |
◆ Recombinant Proteins | ||
ANO10-4838HF | Recombinant Full Length Human ANO10 Protein, GST-tagged | +Inquiry |
ANO10-4216H | Recombinant Human ANO10 Protein, GST-tagged | +Inquiry |
ANO10-1697M | Recombinant Mouse ANO10 Protein | +Inquiry |
ANO10-567M | Recombinant Mouse ANO10 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANO10 Products
Required fields are marked with *
My Review for All ANO10 Products
Required fields are marked with *