Recombinant Full Length Human ARSB Protein, C-Flag-tagged
Cat.No. : | ARSB-1862HFL |
Product Overview : | Recombinant Full Length Human ARSB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targeted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 56 kDa |
AA Sequence : | MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTP HLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTT HMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMY STNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNV TAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHI SDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLP EYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSRE YPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Glycosaminoglycan degradation, Lysosome, Metabolic pathways |
Full Length : | Full L. |
Gene Name | ARSB arylsulfatase B [ Homo sapiens (human) ] |
Official Symbol | ARSB |
Synonyms | ASB; G4S; MPS6 |
Gene ID | 411 |
mRNA Refseq | NM_000046.5 |
Protein Refseq | NP_000037.2 |
MIM | 611542 |
UniProt ID | P15848 |
◆ Recombinant Proteins | ||
ARSB-1839S | Recombinant Staphylococcus aureus (strain: TPS162) ARSB protein, His-tagged | +Inquiry |
ARSB-599H | Recombinant Human ARSB protein, His-tagged | +Inquiry |
ARSB-862H | Recombinant Human ARSB protein, GST-tagged | +Inquiry |
Arsb-3659R | Recombinant Rat Arsb, His-tagged | +Inquiry |
ARSB-3370H | Recombinant Human ARSB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARSB-8677HCL | Recombinant Human ARSB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARSB Products
Required fields are marked with *
My Review for All ARSB Products
Required fields are marked with *
0
Inquiry Basket