Recombinant Full Length Human ASIP Protein, C-Flag-tagged
Cat.No. : | ASIP-917HFL |
Product Overview : | Recombinant Full Length Human ASIP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 12 kDa |
AA Sequence : | MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKK RSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Protein Pathways : | Melanogenesis |
Full Length : | Full L. |
Gene Name | ASIP agouti signaling protein [ Homo sapiens (human) ] |
Official Symbol | ASIP |
Synonyms | ASP; AGSW; AGTI; AGTIL; SHEP9 |
Gene ID | 434 |
mRNA Refseq | NM_001672.3 |
Protein Refseq | NP_001663.2 |
MIM | 600201 |
UniProt ID | P42127 |
◆ Recombinant Proteins | ||
ASIP-917HFL | Recombinant Full Length Human ASIP Protein, C-Flag-tagged | +Inquiry |
ASIP-018H | Recombinant Human ASIP protein, His-GST-tagged | +Inquiry |
ASIP-6018H | Recombinant Human ASIP protein(23-132aa), His&Myc-tagged | +Inquiry |
ASIP-1930B | Recombinant Bovine ASIP Protein (23-133 aa), His-SUMO-tagged | +Inquiry |
ASIP-825R | Recombinant Rat ASIP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASIP-8651HCL | Recombinant Human ASIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASIP Products
Required fields are marked with *
My Review for All ASIP Products
Required fields are marked with *
0
Inquiry Basket