Recombinant Full Length Human ASPHD2 Protein, GST-tagged

Cat.No. : ASPHD2-5909HF
Product Overview : Human LOC57168 full-length ORF ( AAH36753, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 343 amino acids
Description : ASPHD2 (Aspartate Beta-Hydroxylase Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include dioxygenase activity. An important paralog of this gene is ASPHD1.
Molecular Mass : 63.47 kDa
AA Sequence : MSLEWLVAWSWSLDGLRDCIATGIQSVRDCDTTAVITVACLLVLFVWYCYHVGREQPRPYVSVNSLMQAADANGLQNGYVYCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYLNSRPSIQKPEVFFLPDLPTTPYFSRDAQKHDVEVLERNFQTILCEFETLYKAFSNCSLPQGWKMNSTPSGEWFTFYLVNQGVCVPRNCRKCPRTYRLLGSLRTCIGNNVFGNACISVLSPGTVITEHYGPTNIRIRCHLGLKTPNGCELVVGGEPQCWAEGRCLLFDDSFLHAAFHEGSAEDGPRVVFMVDLWHPNVAAAERQALDFIFAPGR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ASPHD2 aspartate beta-hydroxylase domain containing 2 [ Homo sapiens ]
Official Symbol ASPHD2
Synonyms ASPHD2; aspartate beta-hydroxylase domain containing 2; aspartate beta-hydroxylase domain-containing protein 2; FLJ39838;
Gene ID 57168
mRNA Refseq NM_020437
Protein Refseq NP_065170
UniProt ID Q6ICH7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASPHD2 Products

Required fields are marked with *

My Review for All ASPHD2 Products

Required fields are marked with *

0
cart-icon
0
compare icon