Recombinant Full Length Human ASPHD2 Protein, GST-tagged
Cat.No. : | ASPHD2-5909HF |
Product Overview : | Human LOC57168 full-length ORF ( AAH36753, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 343 amino acids |
Description : | ASPHD2 (Aspartate Beta-Hydroxylase Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include dioxygenase activity. An important paralog of this gene is ASPHD1. |
Molecular Mass : | 63.47 kDa |
AA Sequence : | MSLEWLVAWSWSLDGLRDCIATGIQSVRDCDTTAVITVACLLVLFVWYCYHVGREQPRPYVSVNSLMQAADANGLQNGYVYCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYLNSRPSIQKPEVFFLPDLPTTPYFSRDAQKHDVEVLERNFQTILCEFETLYKAFSNCSLPQGWKMNSTPSGEWFTFYLVNQGVCVPRNCRKCPRTYRLLGSLRTCIGNNVFGNACISVLSPGTVITEHYGPTNIRIRCHLGLKTPNGCELVVGGEPQCWAEGRCLLFDDSFLHAAFHEGSAEDGPRVVFMVDLWHPNVAAAERQALDFIFAPGR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASPHD2 aspartate beta-hydroxylase domain containing 2 [ Homo sapiens ] |
Official Symbol | ASPHD2 |
Synonyms | ASPHD2; aspartate beta-hydroxylase domain containing 2; aspartate beta-hydroxylase domain-containing protein 2; FLJ39838; |
Gene ID | 57168 |
mRNA Refseq | NM_020437 |
Protein Refseq | NP_065170 |
UniProt ID | Q6ICH7 |
◆ Recombinant Proteins | ||
ASPHD2-4987Z | Recombinant Zebrafish ASPHD2 | +Inquiry |
ASPHD2-6754H | Recombinant Human ASPHD2 protein, His-tagged | +Inquiry |
ASPHD2-2931H | Recombinant Human ASPHD2 Protein, MYC/DDK-tagged | +Inquiry |
ASPHD2-798M | Recombinant Mouse ASPHD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASPHD2-831R | Recombinant Rat ASPHD2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASPHD2-42HCL | Recombinant Human ASPHD2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASPHD2 Products
Required fields are marked with *
My Review for All ASPHD2 Products
Required fields are marked with *
0
Inquiry Basket