Recombinant Full Length Human ATG3 Protein, C-Flag-tagged
Cat.No. : | ATG3-1065HFL |
Product Overview : | Recombinant Full Length Human ATG3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.7 kDa |
AA Sequence : | MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTG KQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS ALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYY QTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEG GGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Regulation of autophagy |
Full Length : | Full L. |
Gene Name | ATG3 autophagy related 3 [ Homo sapiens (human) ] |
Official Symbol | ATG3 |
Synonyms | APG3; APG3L; hApg3; PC3-96; APG3-LIKE |
Gene ID | 64422 |
mRNA Refseq | NM_022488.5 |
Protein Refseq | NP_071933.2 |
MIM | 609606 |
UniProt ID | Q9NT62 |
◆ Recombinant Proteins | ||
Atg3-1759M | Recombinant Mouse Atg3 Protein, Myc/DDK-tagged | +Inquiry |
ATG3-440R | Recombinant Rhesus monkey ATG3 Protein, His-tagged | +Inquiry |
ATG3-269R | Recombinant Rhesus Macaque ATG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATG3-35H | Recombinant Human ATG3, His-tagged | +Inquiry |
ATG3-500R | Recombinant Rat ATG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG3-8625HCL | Recombinant Human ATG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG3 Products
Required fields are marked with *
My Review for All ATG3 Products
Required fields are marked with *
0
Inquiry Basket