Recombinant Full Length Human Atp-Sensitive Inward Rectifier Potassium Channel 8(Kcnj8) Protein, His-Tagged
Cat.No. : | RFL13675HF |
Product Overview : | Recombinant Full Length Human ATP-sensitive inward rectifier potassium channel 8(KCNJ8) Protein (Q15842) (1-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-424) |
Form : | Lyophilized powder |
AA Sequence : | MLARKSIIPEEYVLARIAAENLRKPRIRDRLPKARFIAKSGACNLAHKNIREQGRFLQDI FTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIYAYMEKSGMEKSGLESTVC VTNVRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMK TAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEV VPIHQLDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDISATDLANQDLEVIVILEGVV ETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDE KPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQN TSES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNJ8 |
Synonyms | KCNJ8; ATP-sensitive inward rectifier potassium channel 8; Inward rectifier K(+ channel Kir6.1; Potassium channel, inwardly rectifying subfamily J member 8; uKATP-1 |
UniProt ID | Q15842 |
◆ Recombinant Proteins | ||
KCNJ8-260H | Recombinant Human KCNJ8, GST-tagged | +Inquiry |
KCNJ8-4743M | Recombinant Mouse KCNJ8 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNJ8-2182R | Recombinant Rhesus Macaque KCNJ8 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNJ8-2361R | Recombinant Rhesus monkey KCNJ8 Protein, His-tagged | +Inquiry |
RFL322MF | Recombinant Full Length Mouse Atp-Sensitive Inward Rectifier Potassium Channel 8(Kcnj8) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNJ8-5043HCL | Recombinant Human KCNJ8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNJ8 Products
Required fields are marked with *
My Review for All KCNJ8 Products
Required fields are marked with *
0
Inquiry Basket