Recombinant Full Length Human Atp Synthase Lipid-Binding Protein, Mitochondrial(Atp5G1) Protein, His-Tagged
| Cat.No. : | RFL27757HF |
| Product Overview : | Recombinant Full Length Human ATP synthase lipid-binding protein, mitochondrial(ATP5G1) Protein (P05496) (62-136aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (62-136) |
| Form : | Lyophilized powder |
| AA Sequence : | DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM GLFCLMVAFLILFAM |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ATP5G1 |
| Synonyms | ATP5MC1; ATP5G1; ATP synthase F(0 complex subunit C1, mitochondrial; ATP synthase lipid-binding protein; ATP synthase membrane subunit c locus 1; ATP synthase proteolipid P1; ATP synthase proton-transporting mitochondrial F(0 complex subunit C1; ATPase pr |
| UniProt ID | P05496 |
| ◆ Recombinant Proteins | ||
| ATP5G1-286R | Recombinant Rhesus Macaque ATP5G1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP5G1-528R | Recombinant Rat ATP5G1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP5G1-12267Z | Recombinant Zebrafish ATP5G1 | +Inquiry |
| ATP5G1-2135M | Recombinant Mouse ATP5G1 Protein, His-tagged | +Inquiry |
| RFL27600OF | Recombinant Full Length Sheep Atp Synthase Lipid-Binding Protein, Mitochondrial(Atp5G1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP5G1-8600HCL | Recombinant Human ATP5G1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5G1 Products
Required fields are marked with *
My Review for All ATP5G1 Products
Required fields are marked with *
