Recombinant Full Length Human AWAT1 Protein, GST-tagged

Cat.No. : AWAT1-3868HF
Product Overview : Human DGAT2L3 full-length ORF ( AAI53035.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 328 amino acids
Description : The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin. [provided by RefSeq, Sep 2009]
Molecular Mass : 63.03 kDa
AA Sequence : MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPERGGRRSAWVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLILQKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDSRMYKFQSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGEPLPLPQIEKPSQEMVDKYHALYMDALHKLFDQHKTHYGCSETQKLFFL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AWAT1 acyl-CoA wax alcohol acyltransferase 1 [ Homo sapiens (human) ]
Official Symbol AWAT1
Synonyms DGAT2L3; AWAT1; acyl-CoA wax alcohol acyltransferase 1; DGA2; acyl-CoA wax alcohol acyltransferase 1; diacyl-glycerol acyltransferase 2; diacylglycerol O-acyltransferase 2-like 3; diacylglycerol O-acyltransferase 2-like protein 3; diacylglycerol acyltransferase 2; long-chain-alcohol O-fatty-acyltransferase 1; EC 2.3.1.75
Gene ID 158833
mRNA Refseq NM_001013579
Protein Refseq NP_001013597
MIM 300924
UniProt ID Q58HT5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AWAT1 Products

Required fields are marked with *

My Review for All AWAT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon