Recombinant Full Length Human AWAT1 Protein, GST-tagged
Cat.No. : | AWAT1-3868HF |
Product Overview : | Human DGAT2L3 full-length ORF ( AAI53035.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 328 amino acids |
Description : | The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin. [provided by RefSeq, Sep 2009] |
Molecular Mass : | 63.03 kDa |
AA Sequence : | MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPERGGRRSAWVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLILQKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDSRMYKFQSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGEPLPLPQIEKPSQEMVDKYHALYMDALHKLFDQHKTHYGCSETQKLFFL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AWAT1 acyl-CoA wax alcohol acyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | AWAT1 |
Synonyms | DGAT2L3; AWAT1; acyl-CoA wax alcohol acyltransferase 1; DGA2; acyl-CoA wax alcohol acyltransferase 1; diacyl-glycerol acyltransferase 2; diacylglycerol O-acyltransferase 2-like 3; diacylglycerol O-acyltransferase 2-like protein 3; diacylglycerol acyltransferase 2; long-chain-alcohol O-fatty-acyltransferase 1; EC 2.3.1.75 |
Gene ID | 158833 |
mRNA Refseq | NM_001013579 |
Protein Refseq | NP_001013597 |
MIM | 300924 |
UniProt ID | Q58HT5 |
◆ Recombinant Proteins | ||
RFL35789MF | Recombinant Full Length Mouse Acyl-Coa Wax Alcohol Acyltransferase 1(Awat1) Protein, His-Tagged | +Inquiry |
RFL22590HF | Recombinant Full Length Human Acyl-Coa Wax Alcohol Acyltransferase 1(Awat1) Protein, His-Tagged | +Inquiry |
AWAT1-2218M | Recombinant Mouse AWAT1 Protein | +Inquiry |
AWAT1-3868HF | Recombinant Full Length Human AWAT1 Protein, GST-tagged | +Inquiry |
AWAT1-5231H | Recombinant Human AWAT1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AWAT1-8556HCL | Recombinant Human AWAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AWAT1 Products
Required fields are marked with *
My Review for All AWAT1 Products
Required fields are marked with *