Recombinant Full Length Human B-Cell Antigen Receptor Complex-Associated Protein Alpha Chain(Cd79A) Protein, His-Tagged
| Cat.No. : | RFL17125HF |
| Product Overview : | Recombinant Full Length Human B-cell antigen receptor complex-associated protein alpha chain(CD79A) Protein (P11912) (33-226aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (33-226) |
| Form : | Lyophilized powder |
| AA Sequence : | LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | CD79A |
| Synonyms | CD79A; IGA; MB1; B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha; MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD antigen CD79a |
| UniProt ID | P11912 |
| ◆ Recombinant Proteins | ||
| Cd79a-6888M | Recombinant Mouse Cd79a protein, His & T7-tagged | +Inquiry |
| CD79A-208H | Recombinant Human CD79A Protein, His-tagged | +Inquiry |
| CD79A-411H | Recombinant Human CD79A Protein, DDK/His-tagged | +Inquiry |
| RFL30044BF | Recombinant Full Length Bovine B-Cell Antigen Receptor Complex-Associated Protein Alpha Chain(Cd79A) Protein, His-Tagged | +Inquiry |
| CD79A-2637H | Recombinant Human CD79A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD79A-7673HCL | Recombinant Human CD79A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD79A Products
Required fields are marked with *
My Review for All CD79A Products
Required fields are marked with *



