Recombinant Full Length Human B9D2 Protein, GST-tagged

Cat.No. : B9D2-1749HF
Product Overview : Human B9D2 full-length ORF ( NP_085055.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 175 amino acids
Description : This gene encodes a B9 domain protein, which are exclusively found in ciliated organisms. The gene is upregulated during mucociliary differentiation, and the encoded protein localizes to basal bodies and cilia. Disrupting expression of this gene results in ciliogenesis defects.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 45.7 kDa
AA Sequence : MAEVHVIGQIMGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name B9D2 B9 protein domain 2 [ Homo sapiens ]
Official Symbol B9D2
Synonyms B9D2; B9 protein domain 2; B9 domain-containing protein 2; MGC4093; MKS1-related protein 2; involved in cIlia stability-1; MKS10; MKSR2; ICIS-1
Gene ID 80776
mRNA Refseq NM_030578
Protein Refseq NP_085055
MIM 611951
UniProt ID Q9BPU9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All B9D2 Products

Required fields are marked with *

My Review for All B9D2 Products

Required fields are marked with *

0
cart-icon
0
compare icon