Recombinant Full Length Human B9D2 Protein, GST-tagged
Cat.No. : | B9D2-1749HF |
Product Overview : | Human B9D2 full-length ORF ( NP_085055.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 175 amino acids |
Description : | This gene encodes a B9 domain protein, which are exclusively found in ciliated organisms. The gene is upregulated during mucociliary differentiation, and the encoded protein localizes to basal bodies and cilia. Disrupting expression of this gene results in ciliogenesis defects. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 45.7 kDa |
AA Sequence : | MAEVHVIGQIMGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | B9D2 B9 protein domain 2 [ Homo sapiens ] |
Official Symbol | B9D2 |
Synonyms | B9D2; B9 protein domain 2; B9 domain-containing protein 2; MGC4093; MKS1-related protein 2; involved in cIlia stability-1; MKS10; MKSR2; ICIS-1 |
Gene ID | 80776 |
mRNA Refseq | NM_030578 |
Protein Refseq | NP_085055 |
MIM | 611951 |
UniProt ID | Q9BPU9 |
◆ Recombinant Proteins | ||
B9D2-501R | Recombinant Rhesus monkey B9D2 Protein, His-tagged | +Inquiry |
B9D2-1749HF | Recombinant Full Length Human B9D2 Protein, GST-tagged | +Inquiry |
B9D2-2260M | Recombinant Mouse B9D2 Protein | +Inquiry |
B9D2-942M | Recombinant Mouse B9D2 Protein, His (Fc)-Avi-tagged | +Inquiry |
B9D2-583R | Recombinant Rat B9D2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
B9D2-8535HCL | Recombinant Human B9D2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B9D2 Products
Required fields are marked with *
My Review for All B9D2 Products
Required fields are marked with *