Recombinant Full Length Human BASP1 Protein, GST-tagged
Cat.No. : | BASP1-1819HF |
Product Overview : | Human BASP1 full-length ORF ( NP_006308.3, 1 a.a. - 227 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 227 amino acids |
Description : | This gene encodes a membrane bound protein with several transient phosphorylation sites and PEST motifs. Conservation of proteins with PEST sequences among different species supports their functional significance. PEST sequences typically occur in proteins with high turnover rates. Immunological characteristics of this protein are species specific. This protein also undergoes N-terminal myristoylation. [provided by RefSeq |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 50.6 kDa |
AA Sequence : | MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAPAEPAEAKEGKEKPDQDAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPLRGGEAPKAAEAAAGPRPRAAPAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVKE |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BASP1 brain abundant, membrane attached signal protein 1 [ Homo sapiens ] |
Official Symbol | BASP1 |
Synonyms | BASP1; brain abundant, membrane attached signal protein 1; brain acid soluble protein 1; CAP 23; CAP23; NAP 22; NAP22; brain acid-soluble protein 1; neuronal axonal membrane protein NAP-22; neuronal tissue-enriched acidic protein; 22 kDa neuronal tissue-enriched acidic protein; CAP-23; NAP-22; MGC8555 |
Gene ID | 10409 |
mRNA Refseq | NM_006317 |
Protein Refseq | NP_006308 |
MIM | 605940 |
UniProt ID | P80723 |
◆ Recombinant Proteins | ||
BASP1-966M | Recombinant Mouse BASP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BASP1-1819HF | Recombinant Full Length Human BASP1 Protein, GST-tagged | +Inquiry |
BASP1-5692C | Recombinant Chicken BASP1 | +Inquiry |
BASP1-296H | Recombinant Human BASP1 Protein, His-tagged | +Inquiry |
BASP1-2530H | Recombinant Human BASP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BASP1 Products
Required fields are marked with *
My Review for All BASP1 Products
Required fields are marked with *