Recombinant Full Length Human BBS9 Protein, GST-tagged
| Cat.No. : | BBS9-1704HF |
| Product Overview : | Human B1 full-length ORF ( AAH32715, 1 a.a. - 310 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 310 amino acids |
| Description : | This gene is downregulated by parathyroid hormone in osteoblastic cells, and therefore, is thought to be involved in parathyroid hormone action in bones. The exact function of this gene has not yet been determined. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 59.84 kDa |
| AA Sequence : | MGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLQFSLWKHLLPRSSTLEK |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | BBS9 Bardet-Biedl syndrome 9 [ Homo sapiens (human) ] |
| Official Symbol | BBS9 |
| Synonyms | B1; D1; C18; PTHB1; BBS9 |
| Gene ID | 27241 |
| mRNA Refseq | NM_001033604.1 |
| Protein Refseq | NP_001028776.1 |
| MIM | 607968 |
| UniProt ID | Q3SYG4 |
| ◆ Recombinant Proteins | ||
| BBS9-977M | Recombinant Mouse BBS9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BBS9-2305H | Recombinant Human BBS9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Bbs9-1830M | Recombinant Mouse Bbs9 Protein, Myc/DDK-tagged | +Inquiry |
| BBS9-1704HF | Recombinant Full Length Human BBS9 Protein, GST-tagged | +Inquiry |
| BBS9-001H | Recombinant Human BBS9 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BBS9-8500HCL | Recombinant Human BBS9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BBS9 Products
Required fields are marked with *
My Review for All BBS9 Products
Required fields are marked with *
