Recombinant Full Length Human BCKDHB Protein, C-Flag-tagged
Cat.No. : | BCKDHB-1763HFL |
Product Overview : | Recombinant Full Length Human BCKDHB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the E1 beta subunit of branched-chain keto acid dehydrogenase, which is a multienzyme complex associated with the inner membrane of mitochondria. This enzyme complex functions in the catabolism of branched-chain amino acids. Mutations in this gene have been associated with maple syrup urine disease (MSUD), type 1B, a disease characterized by a maple syrup odor to the urine in addition to mental and physical retardation and feeding problems. Alternative splicing at this locus results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.8 kDa |
AA Sequence : | MAVVAAAAGWLLRLRAAGAEGHWRRLPGAGLARGFLHPAATVEDAAQRRQVAHFTFQPDPEPREYGQTQK MNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTG ATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGI KVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQ VHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECF LNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Metabolic pathways, Valine, leucine and isoleucine degradation |
Full Length : | Full L. |
Gene Name | BCKDHB branched chain keto acid dehydrogenase E1 subunit beta [ Homo sapiens (human) ] |
Official Symbol | BCKDHB |
Synonyms | E1B; BCKDE1B; BCKDH E1-beta |
Gene ID | 594 |
mRNA Refseq | NM_183050.4 |
Protein Refseq | NP_898871.1 |
MIM | 248611 |
UniProt ID | P21953 |
◆ Recombinant Proteins | ||
BCKDHB-436H | Recombinant Human BCKDHB Protein, His (Fc)-Avi-tagged | +Inquiry |
BCKDHB-1763HFL | Recombinant Full Length Human BCKDHB Protein, C-Flag-tagged | +Inquiry |
BCKDHB-6225C | Recombinant Chicken BCKDHB | +Inquiry |
BCKDHB-985M | Recombinant Mouse BCKDHB Protein, His (Fc)-Avi-tagged | +Inquiry |
BCKDHB-612R | Recombinant Rat BCKDHB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCKDHB-8493HCL | Recombinant Human BCKDHB 293 Cell Lysate | +Inquiry |
BCKDHB-8492HCL | Recombinant Human BCKDHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCKDHB Products
Required fields are marked with *
My Review for All BCKDHB Products
Required fields are marked with *
0
Inquiry Basket