Recombinant Full Length Human Bet1 Homolog(Bet1) Protein, His-Tagged
Cat.No. : | RFL35113HF |
Product Overview : | Recombinant Full Length Human BET1 homolog(BET1) Protein (O15155) (1-118aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-118) |
Form : | Lyophilized powder |
AA Sequence : | MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BET1 |
Synonyms | BET1; BET1 homolog; hBET1; Golgi vesicular membrane-trafficking protein p18 |
UniProt ID | O15155 |
◆ Recombinant Proteins | ||
BET1-1575HF | Recombinant Full Length Human BET1 Protein, GST-tagged | +Inquiry |
RFL35113HF | Recombinant Full Length Human Bet1 Homolog(Bet1) Protein, His-Tagged | +Inquiry |
BET1-627R | Recombinant Rat BET1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BET1-360R | Recombinant Rhesus Macaque BET1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL8421MF | Recombinant Full Length Mouse Bet1 Homolog(Bet1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BET1-8465HCL | Recombinant Human BET1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BET1 Products
Required fields are marked with *
My Review for All BET1 Products
Required fields are marked with *
0
Inquiry Basket