Recombinant Full Length Human BNIP2 Protein, GST-tagged
| Cat.No. : | BNIP2-3757HF |
| Product Overview : | Human BNIP2 full-length ORF ( AAH02461, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 314 amino acids |
| Description : | This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. Though the specific function is unknown, it interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 60.28 kDa |
| AA Sequence : | MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BNIP2 BCL2 interacting protein 2 [ Homo sapiens (human) ] |
| Official Symbol | BNIP2 |
| Synonyms | BNIP2; BCL2/adenovirus E1B 19kDa interacting protein 2; BCL2/adenovirus E1B 19kD interacting protein 2; BCL2/adenovirus E1B 19 kDa protein-interacting protein 2; BNIP 2; Nip2; NIP2; BNIP-2; |
| Gene ID | 663 |
| mRNA Refseq | NM_004330 |
| Protein Refseq | NP_004321 |
| MIM | 603292 |
| UniProt ID | Q12982 |
| ◆ Recombinant Proteins | ||
| BNIP2-4995H | Recombinant Human BNIP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BNIP2-45H | Recombinant Human BNIP2, His-tagged | +Inquiry |
| BNIP2-3757HF | Recombinant Full Length Human BNIP2 Protein, GST-tagged | +Inquiry |
| BNIP2-11430Z | Recombinant Zebrafish BNIP2 | +Inquiry |
| BNIP2-293H | Recombinant Human BNIP2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BNIP2-8424HCL | Recombinant Human BNIP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BNIP2 Products
Required fields are marked with *
My Review for All BNIP2 Products
Required fields are marked with *
