Recombinant Full Length Human BOLA1 Protein, GST-tagged
Cat.No. : | BOLA1-3763HF |
Product Overview : | Human BOLA1 full-length ORF ( NP_057158.1, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 137 amino acids |
Description : | This gene encodes a mitochondrial protein that function as a translational activator of mitochondrially-encoded cytochrome c oxidase 1. Mutations in this gene are associated with Leigh syndrome. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 40.7 kDa |
AA Sequence : | MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BOLA1 bolA homolog 1 (E. coli) [ Homo sapiens ] |
Official Symbol | BOLA1 |
Synonyms | BOLA1; bolA homolog 1 (E. coli); bolA like 1 (E. coli); bolA-like protein 1; CGI 143; bolA-like 1; hBolA; CGI-143; MGC75015; RP11-196G18.18; |
Gene ID | 51027 |
mRNA Refseq | NM_016074 |
Protein Refseq | NP_057158 |
MIM | 613181 |
UniProt ID | Q9Y3E2 |
◆ Recombinant Proteins | ||
BOLA1-10267H | Recombinant Human BOLA1, His-tagged | +Inquiry |
BOLA1-990Z | Recombinant Zebrafish BOLA1 | +Inquiry |
BOLA1-7129H | Recombinant Human BOLA1, His-tagged | +Inquiry |
Bola1-1881M | Recombinant Mouse Bola1 Protein, Myc/DDK-tagged | +Inquiry |
BOLA1-3763HF | Recombinant Full Length Human BOLA1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BOLA1-173HCL | Recombinant Human BOLA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BOLA1 Products
Required fields are marked with *
My Review for All BOLA1 Products
Required fields are marked with *
0
Inquiry Basket