Recombinant Full Length Human BPGM Protein, C-Flag-tagged

Cat.No. : BPGM-761HFL
Product Overview : Recombinant Full Length Human BPGM Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : 2,3-diphosphoglycerate (2,3-DPG) is a small molecule found at high concentrations in red blood cells where it binds to and decreases the oxygen affinity of hemoglobin. This gene encodes a multifunctional enzyme that catalyzes 2,3-DPG synthesis via its synthetase activity, and 2,3-DPG degradation via its phosphatase activity. The enzyme also has phosphoglycerate phosphomutase activity. Deficiency of this enzyme increases the affinity of cells for oxygen. Mutations in this gene result in hemolytic anemia. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 29.8 kDa
AA Sequence : MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLI LEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDR RYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINI
TLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Glycolysis / Gluconeogenesis, Metabolic pathways
Full Length : Full L.
Gene Name BPGM bisphosphoglycerate mutase [ Homo sapiens (human) ]
Official Symbol BPGM
Synonyms DPGM; ECYT8
Gene ID 669
mRNA Refseq NM_199186.3
Protein Refseq NP_954655.1
MIM 613896
UniProt ID P07738

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BPGM Products

Required fields are marked with *

My Review for All BPGM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon