Recombinant Full Length Human BPGM Protein, C-Flag-tagged
Cat.No. : | BPGM-761HFL |
Product Overview : | Recombinant Full Length Human BPGM Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | 2,3-diphosphoglycerate (2,3-DPG) is a small molecule found at high concentrations in red blood cells where it binds to and decreases the oxygen affinity of hemoglobin. This gene encodes a multifunctional enzyme that catalyzes 2,3-DPG synthesis via its synthetase activity, and 2,3-DPG degradation via its phosphatase activity. The enzyme also has phosphoglycerate phosphomutase activity. Deficiency of this enzyme increases the affinity of cells for oxygen. Mutations in this gene result in hemolytic anemia. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.8 kDa |
AA Sequence : | MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLI LEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDR RYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINI TLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Glycolysis / Gluconeogenesis, Metabolic pathways |
Full Length : | Full L. |
Gene Name | BPGM bisphosphoglycerate mutase [ Homo sapiens (human) ] |
Official Symbol | BPGM |
Synonyms | DPGM; ECYT8 |
Gene ID | 669 |
mRNA Refseq | NM_199186.3 |
Protein Refseq | NP_954655.1 |
MIM | 613896 |
UniProt ID | P07738 |
◆ Recombinant Proteins | ||
BPGM-667H | Recombinant Human 2,3-Bisphosphoglycerate Mutase, His-tagged | +Inquiry |
BPGM-556R | Recombinant Rhesus monkey BPGM Protein, His-tagged | +Inquiry |
Bpgm-8194M | Recombinant Mouse Bpgm protein, His & T7-tagged | +Inquiry |
BPGM-2467C | Recombinant Chicken BPGM | +Inquiry |
BPGM-453H | Recombinant Human BPGM Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BPGM-8417HCL | Recombinant Human BPGM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPGM Products
Required fields are marked with *
My Review for All BPGM Products
Required fields are marked with *
0
Inquiry Basket