Recombinant Full Length Human Brain Mitochondrial Carrier Protein 1(Slc25A14) Protein, His-Tagged
| Cat.No. : | RFL23822HF |
| Product Overview : | Recombinant Full Length Human Brain mitochondrial carrier protein 1(SLC25A14) Protein (O95258) (1-325aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-325) |
| Form : | Lyophilized powder |
| AA Sequence : | MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFP VDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTI KIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSM IGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFV SSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFW PNWLRLGPWNIIFFITYEQLKRLQI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SLC25A14 |
| Synonyms | SLC25A14; BMCP1; UCP5; UNQ791/PRO1682; Brain mitochondrial carrier protein 1; BMCP-1; Mitochondrial uncoupling protein 5; UCP 5; Solute carrier family 25 member 14 |
| UniProt ID | O95258 |
| ◆ Recombinant Proteins | ||
| SLC25A14-2099C | Recombinant Chicken SLC25A14 | +Inquiry |
| RFL23822HF | Recombinant Full Length Human Brain Mitochondrial Carrier Protein 1(Slc25A14) Protein, His-Tagged | +Inquiry |
| SLC25A14-4059R | Recombinant Rhesus Macaque SLC25A14 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC25A14-532H | Recombinant Human SLC25A14 Protein, His-tagged | +Inquiry |
| SLC25A14-10511Z | Recombinant Zebrafish SLC25A14 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC25A14-1782HCL | Recombinant Human SLC25A14 293 Cell Lysate | +Inquiry |
| SLC25A14-1781HCL | Recombinant Human SLC25A14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A14 Products
Required fields are marked with *
My Review for All SLC25A14 Products
Required fields are marked with *
