Recombinant Full Length Human BRF2 Protein, GST-tagged

Cat.No. : BRF2-3795HF
Product Overview : Human BRF2 full-length ORF ( AAH10648, 1 a.a. - 419 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 419 amino acids
Description : This gene encodes one of the multiple subunits of the RNA polymerase III transcription factor complex required for transcription of genes with promoter elements upstream of the initiation site. The product of this gene, a TFIIB-like factor, is directly recruited to the TATA-box of polymerase III small nuclear RNA gene promoters through its interaction with the TATA-binding protein.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 71.83 kDa
AA Sequence : MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BRF2 BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like [ Homo sapiens ]
Official Symbol BRF2
Synonyms BRF2; BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like; transcription factor IIIB 50 kDa subunit; BRFU; FLJ11052; TFIIIB50; BRF-2; hBRFU; hTFIIIB50; B-related factor 2; transcription factor IIB- related factor, TFIIIB50; RNA polymerase III transcription initiation factor BRFU;
Gene ID 55290
mRNA Refseq NM_018310
Protein Refseq NP_060780
MIM 607013
UniProt ID Q9HAW0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRF2 Products

Required fields are marked with *

My Review for All BRF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon