Recombinant Full Length Human BRMS1L Protein, GST-tagged
Cat.No. : | BRMS1L-3800HF |
Product Overview : | Human BRMS1L full-length ORF ( NP_115728.2, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 323 amino acids |
Description : | The protein encoded by this gene shows sequence similarity to the human breast carcinoma metastasis suppressor (BRMS1) protein and the mammalian Sds3 (suppressor of defective silencing 3) proteins. This protein is a component of the mSin3a family of histone deacetylase complexes (HDAC). |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 64 kDa |
AA Sequence : | MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRKKRKDPFSPDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSIKHS |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BRMS1L breast cancer metastasis-suppressor 1-like [ Homo sapiens ] |
Official Symbol | BRMS1L |
Synonyms | BRMS1L; breast cancer metastasis-suppressor 1-like; breast cancer metastasis suppressor 1 , BRMS1; breast cancer metastasis-suppressor 1-like protein; FLJ39177; MGC11296; BRMS1-like protein p40; BRMS1-homolog protein p40; BRMS1; |
Gene ID | 84312 |
mRNA Refseq | NM_032352 |
Protein Refseq | NP_115728 |
MIM | 618514 |
UniProt ID | Q5PSV4 |
◆ Recombinant Proteins | ||
BRMS1L-2497M | Recombinant Mouse BRMS1L Protein | +Inquiry |
BRMS1L-396R | Recombinant Rhesus Macaque BRMS1L Protein, His (Fc)-Avi-tagged | +Inquiry |
BRMS1L-3800HF | Recombinant Full Length Human BRMS1L Protein, GST-tagged | +Inquiry |
BRMS1L-1093M | Recombinant Mouse BRMS1L Protein, His (Fc)-Avi-tagged | +Inquiry |
BRMS1L-1166H | Recombinant Human BRMS1L protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRMS1L Products
Required fields are marked with *
My Review for All BRMS1L Products
Required fields are marked with *