Recombinant Full Length Human BRMS1L Protein, GST-tagged

Cat.No. : BRMS1L-3800HF
Product Overview : Human BRMS1L full-length ORF ( NP_115728.2, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 323 amino acids
Description : The protein encoded by this gene shows sequence similarity to the human breast carcinoma metastasis suppressor (BRMS1) protein and the mammalian Sds3 (suppressor of defective silencing 3) proteins. This protein is a component of the mSin3a family of histone deacetylase complexes (HDAC).
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 64 kDa
AA Sequence : MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRKKRKDPFSPDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSIKHS
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BRMS1L breast cancer metastasis-suppressor 1-like [ Homo sapiens ]
Official Symbol BRMS1L
Synonyms BRMS1L; breast cancer metastasis-suppressor 1-like; breast cancer metastasis suppressor 1 , BRMS1; breast cancer metastasis-suppressor 1-like protein; FLJ39177; MGC11296; BRMS1-like protein p40; BRMS1-homolog protein p40; BRMS1;
Gene ID 84312
mRNA Refseq NM_032352
Protein Refseq NP_115728
MIM 618514
UniProt ID Q5PSV4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRMS1L Products

Required fields are marked with *

My Review for All BRMS1L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon