Recombinant Full Length Human BST1 Protein, GST-tagged
Cat.No. : | BST1-3747HF |
Product Overview : | Human BST1 full-length ORF ( AAH12095.1, 1 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 318 amino acids |
Description : | Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 60.39 kDa |
AA Sequence : | MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BST1 bone marrow stromal cell antigen 1 [ Homo sapiens ] |
Official Symbol | BST1 |
Synonyms | BST1; bone marrow stromal cell antigen 1; ADP-ribosyl cyclase 2; ADP ribosyl cyclase 2; CD157; NAD(+) nucleosidase; BST-1; cADPr hydrolase 2; bone marrow stromal antigen 1; cyclic ADP-ribose hydrolase 2; |
Gene ID | 683 |
mRNA Refseq | NM_004334 |
Protein Refseq | NP_004325 |
MIM | 600387 |
UniProt ID | Q10588 |
◆ Cell & Tissue Lysates | ||
BST1-1401RCL | Recombinant Rat BST1 cell lysate | +Inquiry |
BST1-2801HCL | Recombinant Human BST1 cell lysate | +Inquiry |
BST1-2620MCL | Recombinant Mouse BST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BST1 Products
Required fields are marked with *
My Review for All BST1 Products
Required fields are marked with *
0
Inquiry Basket