Recombinant Full Length Human BTNL8 Protein, C-Flag-tagged
Cat.No. : | BTNL8-1297HFL |
Product Overview : | Recombinant Full Length Human BTNL8 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable signaling receptor binding activity. Predicted to be involved in T cell receptor signaling pathway and regulation of cytokine production. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 56.6 kDa |
AA Sequence : | MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEAMEVRFFRGQFSSVVHLYRDG KDQPFMQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQSYYQKAIWELQVSALGSVPLI SITGYVDRDIQLLCQSSGWFPRPTAKWKGPQGQDLSTDSRTNRDMHGLFDVEISLTVQENAGSISCSMRH AHLSREVESRVQIGDTFFEPISWHLATKVLGILCCGLFFGIVGLKIFFSKFQWKIQAELDWRRKHGQAEL RDARKHAVEVTLDPETAHPKLCVSDLKTVTHRKAPQEVPHSEKRFTRKSVVASQSFQAGKHYWEVDGGHN KRWRVGVCRDDVDRRKEYVTLSPDHGYWVLRLNGEHLYFTLNPRFISVFPRTPPTKIGVFLDYECGTISF FNINDQSLIYTLTCRFEGLLRPYIEYPSYNEQNGTPIVICPVTQESEKEASWQRASAIPETSNSESSSQA TTPFLPRGEMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | BTNL8 butyrophilin like 8 [ Homo sapiens (human) ] |
Official Symbol | BTNL8 |
Synonyms | BTN9.2 |
Gene ID | 79908 |
mRNA Refseq | NM_001040462.3 |
Protein Refseq | NP_001035552.1 |
MIM | 615606 |
UniProt ID | Q6UX41 |
◆ Recombinant Proteins | ||
BTNL8-986H | Recombinant Human BTNL8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BTNL8-186H | Active Recombinant Human BTNL8 protein, Fc-tagged | +Inquiry |
BTNL8-461H | Recombinant Human BTNL8 Protein, His (Fc)-Avi-tagged | +Inquiry |
BTNL8-1297HFL | Recombinant Full Length Human BTNL8 Protein, C-Flag-tagged | +Inquiry |
BTNL8-2814H | Recombinant Human BTNL8 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTNL8 Products
Required fields are marked with *
My Review for All BTNL8 Products
Required fields are marked with *
0
Inquiry Basket