Recombinant Full Length Human BZW2 Protein, GST-tagged

Cat.No. : BZW2-1699HF
Product Overview : Human BZW2 full-length ORF ( NP_054757.1, 1 a.a. - 419 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 419 amino acids
Description : Enables cadherin binding activity. Predicted to be involved in cell differentiation and nervous system development. Located in cytoplasm.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 74.6 kDa
AA Sequence : MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BZW2 basic leucine zipper and W2 domains 2 [ Homo sapiens ]
Official Symbol BZW2
Synonyms BZW2; basic leucine zipper and W2 domains 2; basic leucine zipper and W2 domain-containing protein 2; HSPC028; MST017; MSTP017
Gene ID 28969
mRNA Refseq NM_001159767
Protein Refseq NP_001153239
MIM 619275
UniProt ID Q9Y6E2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BZW2 Products

Required fields are marked with *

My Review for All BZW2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon