Recombinant Full Length Human C12orf76 Protein, GST-tagged
Cat.No. : | C12orf76-4907HF |
Product Overview : | Human FLJ40142 full-length ORF (BAC05063.1, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 135 amino acids |
Description : | C12orf76 (Chromosome 12 Open Reading Frame 76) is a Protein Coding gene. GO annotations related to this gene include ion channel activity and purinergic nucleotide receptor activity. |
Molecular Mass : | 41.25 kDa |
AA Sequence : | MFQNLQGTFEKEIGKIIPFTIAFKRAEAVEPDGCVQSWRCCLPCDLGQASRFIHTTVCSAIRWRSCKGERNFAERHILPAELEEQSNHAGMGPILPAMPSVDGNHFQHPAGDCHPYGILCLQAHSASVTARQVLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C12orf76 chromosome 12 open reading frame 76 [ Homo sapiens (human) ] |
Official Symbol | C12orf76 |
Synonyms | C12orf76; chromosome 12 open reading frame 76; uncharacterized protein C12orf76 |
Gene ID | 400073 |
mRNA Refseq | NM_207435 |
Protein Refseq | NP_997318 |
UniProt ID | Q8N812 |
◆ Recombinant Proteins | ||
C12orf76-4907HF | Recombinant Full Length Human C12orf76 Protein, GST-tagged | +Inquiry |
C12orf76-625H | Recombinant Human C12orf76 Protein, His-tagged | +Inquiry |
C12orf76-4335H | Recombinant Human C12orf76 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C12orf76-8306HCL | Recombinant Human C12orf76 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C12orf76 Products
Required fields are marked with *
My Review for All C12orf76 Products
Required fields are marked with *
0
Inquiry Basket