Recombinant Human C12orf76 Protein, GST-tagged

Cat.No. : C12orf76-4335H
Product Overview : Human FLJ40142 full-length ORF (BAC05063.1, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C12orf76 (Chromosome 12 Open Reading Frame 76) is a Protein Coding gene. GO annotations related to this gene include ion channel activity and purinergic nucleotide receptor activity.
Molecular Mass : 41.25 kDa
AA Sequence : MFQNLQGTFEKEIGKIIPFTIAFKRAEAVEPDGCVQSWRCCLPCDLGQASRFIHTTVCSAIRWRSCKGERNFAERHILPAELEEQSNHAGMGPILPAMPSVDGNHFQHPAGDCHPYGILCLQAHSASVTARQVLQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C12orf76 chromosome 12 open reading frame 76 [ Homo sapiens (human) ]
Official Symbol C12orf76
Synonyms C12orf76; chromosome 12 open reading frame 76; uncharacterized protein C12orf76
Gene ID 400073
mRNA Refseq NM_207435
Protein Refseq NP_997318
UniProt ID Q8N812

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C12orf76 Products

Required fields are marked with *

My Review for All C12orf76 Products

Required fields are marked with *

0
cart-icon
0
compare icon