Recombinant Full Length Human C1QL1 Protein, C-Flag-tagged

Cat.No. : C1QL1-1625HFL
Product Overview : Recombinant Full Length Human C1QL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Predicted to enable signaling receptor binding activity. Predicted to act upstream of or within maintenance of synapse structure; motor learning; and neuron remodeling. Predicted to be located in several cellular components, including climbing fiber; presynapse; and synaptic cleft. Predicted to be part of collagen trimer.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 26.3 kDa
AA Sequence : MLLVLVVLIPVLVSSGGPEGHYEMLGTCRMVCDPYPARGPGAGARTDGGDALSEQSGAPPPSTLVQGPQG KPGRTGKPGPPGPPGDPGPPGPVGPPGEKGEPGKPGPPGLPGAGGSGAISTATYTTVPRVAFYAGLKNPH EGYEVLKFDDVVTNLGNNYDAASGKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDAD
QNYDYASNSVILHLDAGDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Secreted Protein
Full Length : Full L.
Gene Name C1QL1 complement C1q like 1 [ Homo sapiens (human) ]
Official Symbol C1QL1
Synonyms CRF; C1QRF; CTRP14; C1QTNF14
Gene ID 10882
mRNA Refseq NM_006688.5
Protein Refseq NP_006679.1
MIM 611586
UniProt ID O75973

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C1QL1 Products

Required fields are marked with *

My Review for All C1QL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon