Recombinant Full Length Human C1QTNF3 Protein, C-Flag-tagged
Cat.No. : | C1QTNF3-1852HFL |
Product Overview : | Recombinant Full Length Human C1QTNF3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables identical protein binding activity. Involved in several processes, including cellular triglyceride homeostasis; negative regulation of NIK/NF-kappaB signaling; and regulation of cytokine production. Acts upstream of or within negative regulation of gluconeogenesis. Located in extracellular exosome and membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35 kDa |
AA Sequence : | MLWRQLIYWQLLALFFLPFCLCQDEYMEVSGRTNKVVARIVQSHQQTGRSGSRREKVRERSHPKTGTVDN NTSTDLKSLRPDELPHPEVDDLAQITTFWGQSPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGN HGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIF SSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNH AVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | C1QTNF3 C1q and TNF related 3 [ Homo sapiens (human) ] |
Official Symbol | C1QTNF3 |
Synonyms | CORS; CORCS; CTRP3; CORS26; C1ATNF3; CORS-26 |
Gene ID | 114899 |
mRNA Refseq | NM_181435.6 |
Protein Refseq | NP_852100.3 |
MIM | 612045 |
UniProt ID | Q9BXJ4 |
◆ Recombinant Proteins | ||
C1QTNF3-467H | Recombinant Human C1QTNF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
C1QTNF3-234H | Recombinant Human C1QTNF3, His-tagged | +Inquiry |
C1QTNF3-2801Z | Recombinant Zebrafish C1QTNF3 | +Inquiry |
C1QTNF3-3322H | Recombinant Human C1QTNF3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C1QTNF3-4240H | Recombinant Human C1q And Tumor Necrosis Factor Related Protein 3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QTNF3-8137HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
C1QTNF3-8136HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QTNF3 Products
Required fields are marked with *
My Review for All C1QTNF3 Products
Required fields are marked with *