Recombinant Full Length Human C1QTNF9 Protein, GST-tagged
| Cat.No. : | C1QTNF9-6426HF |
| Product Overview : | Human MGC48915 full-length ORF ( AAH40438.1, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 333 amino acids |
| Description : | C1QTNF9 (C1q And TNF Related 9) is a Protein Coding gene. GO annotations related to this gene include hormone activity. An important paralog of this gene is C1QTNF9B. |
| Molecular Mass : | 61 kDa |
| AA Sequence : | MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDVPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C1QTNF9 C1q and tumor necrosis factor related protein 9 [ Homo sapiens ] |
| Official Symbol | C1QTNF9 |
| Synonyms | C1QTNF9; C1q and tumor necrosis factor related protein 9; complement C1q and tumor necrosis factor-related protein 9A; AQL1; C1QTNF9A; CTRP9; MGC48915; complement C1q tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9A; complement C1q and tumor necrosis factor-related protein 9; |
| Gene ID | 338872 |
| mRNA Refseq | NM_178540 |
| Protein Refseq | NP_848635 |
| MIM | 614285 |
| UniProt ID | P0C862 |
| ◆ Recombinant Proteins | ||
| C1QTNF9-18H | Active Recombinant Human C1QTNF9 protein, His-tagged | +Inquiry |
| C1QTNF9-2574M | Recombinant Mouse C1QTNF9 Protein | +Inquiry |
| C1QTNF9-6417Z | Recombinant Zebrafish C1QTNF9 | +Inquiry |
| C1QTNF9-2569H | Recombinant Human C1QTNF9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| C1QTNF9-10486H | Recombinant Human C1QTNF9, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C1QTNF9-8134HCL | Recombinant Human C1QTNF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QTNF9 Products
Required fields are marked with *
My Review for All C1QTNF9 Products
Required fields are marked with *



