Recombinant Full Length Human C3orf33 Protein, GST-tagged

Cat.No. : C3orf33-2591HF
Product Overview : Human C3orf33 full-length ORF (BAB70989.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 251 amino acids
Description : C3orf33 (Chromosome 3 Open Reading Frame 33) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and hydrolase activity, acting on ester bonds.
Molecular Mass : 55.7 kDa
AA Sequence : MAIAGIMLLLRSIRLTSKFTSSSDIPVEFIRRNVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGVELAETGKAWLQKELKPSQLLWFQLLGKENSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHRNLLKAELTALKKGEGIWKEDSEKESYLEKFKDSWREIWKKDSFLKTTGSDFSLKKESYYEKLKRTYEIWKDNMNNCSLILKFRELISRINFRRKG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C3orf33 chromosome 3 open reading frame 33 [ Homo sapiens ]
Official Symbol C3orf33
Synonyms C3ORF33; chromosome 3 open reading frame 33; uncharacterized protein C3orf33; AC3 33; FLJ31139; AP-1 activity suppressor; AC3-33;
Gene ID 285315
mRNA Refseq NM_173657
Protein Refseq NP_775928
MIM 619654
UniProt ID Q6P1S2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C3orf33 Products

Required fields are marked with *

My Review for All C3orf33 Products

Required fields are marked with *

0
cart-icon
0
compare icon