Recombinant Full Length Human C4orf45 Protein, GST-tagged

• Cat.No.: C4orf45-2650HF
• Product Overview: Human C4orf45 full-length ORF (BAB71665.1, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 188 amino acids
• Description: C4orf45 (Chromosome 4 Open Reading Frame 45) is a Protein Coding gene.
• Molecular Mass: 48.3 kDa
• AA Sequence: MASVSYQKPTSTTVGKQMIFTGPDYIKDYLPKIHQHTSYVGEQHLALEKTGDLRYLWRPASNRSLPAKYKHKYVGEIGWRIPQYNFINKSRLESGFHIKYEELSQASLDSITHRYQNPWQPKPHVLDMQGEQSRASFAWHMSAFEDTDQRNSKWAILVRQCKSSLPRASKPPKLPKLPKRKRKGNINL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C4orf45 chromosome 4 open reading frame 45 [ Homo sapiens ]
• Official Symbol: C4orf45
• Synonyms: C4ORF45; chromosome 4 open reading frame 45; uncharacterized protein C4orf45; FLJ25371
• Gene ID: 152940
• mRNA Refseq: NM_152543
• Protein Refseq: NP_689756
• UniProt ID: Q96LM5