Recombinant Full Length Human C5orf30 Protein, GST-tagged
| Cat.No. : | C5orf30-2666HF |
| Product Overview : | Human C5orf30 full-length ORF (NP_149988.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 206 amino acids |
| Description : | C5orf30 (Chromosome 5 Open Reading Frame 30) is a Protein Coding gene. Diseases associated with C5orf30 include Rheumatoid Arthritis. |
| Molecular Mass : | 49.5 kDa |
| AA Sequence : | MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEELLKLAQKCTGGEESKAEAMPSLRSKQLDAGLARSSRLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKSLPYEPYKALHGPLPLCLLKGKRAHSKSLDYLNLDKMIKEPADTEVLQYQLQHLTLRGDRVFARNNT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C5orf30 chromosome 5 open reading frame 30 [ Homo sapiens (human) ] |
| Official Symbol | C5orf30 |
| Synonyms | C5orf30; chromosome 5 open reading frame 30; UNC119-binding protein C5orf30; UPF0684 protein C5orf30; Chromosome 5 Open Reading Frame 30; UNC119-Binding Protein |
| Gene ID | 90355 |
| mRNA Refseq | NM_001316968 |
| Protein Refseq | NP_001303897 |
| MIM | 616608 |
| UniProt ID | Q96GV9 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C5orf30 Products
Required fields are marked with *
My Review for All C5orf30 Products
Required fields are marked with *
