Recombinant Full Length Human C5orf46 Protein, GST-tagged
| Cat.No. : | C5orf46-2676HF |
| Product Overview : | Human C5orf46 full-length ORF (AAH21680.1, 1 a.a. - 72 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 72 amino acids |
| Description : | C5orf46 (Chromosome 5 Open Reading Frame 46) is a Protein Coding gene. |
| Molecular Mass : | 34.32 kDa |
| AA Sequence : | MAVLVLRLTVVLGLLVLFLTCYADDKPDKPDDKPDDSGKDPKPDFPKFLSLLGTEIIENAVEFILRSMSRST |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C5orf46 chromosome 5 open reading frame 46 [ Homo sapiens (human) ] |
| Official Symbol | C5orf46 |
| Synonyms | C5orf46; chromosome 5 open reading frame 46; uncharacterized protein C5orf46; CTC-327F10.5; skin and saliva secreted protein 1; |
| Gene ID | 389336 |
| mRNA Refseq | NM_206966 |
| Protein Refseq | NP_996849 |
| UniProt ID | Q6UWT4 |
| ◆ Recombinant Proteins | ||
| C5orf46-2676HF | Recombinant Full Length Human C5orf46 Protein, GST-tagged | +Inquiry |
| C5orf46-0096H | Recombinant Human C5orf46 Protein, GST-Tagged | +Inquiry |
| C5orf46-301343H | Recombinant Human C5orf46 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C5orf46 Products
Required fields are marked with *
My Review for All C5orf46 Products
Required fields are marked with *
