Recombinant Human C5orf46 protein, GST-tagged
| Cat.No. : | C5orf46-301343H |
| Product Overview : | Recombinant Human C5orf46 (24-72 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
| Source : | E. coli |
| Species : | Human |
| Tag : | GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Protein length : | Asp24-Thr72 |
| AA Sequence : | DDKPDKPDDKPDDSGKDPKPDFPKFLSLLGTEIIENAVEFILRSMSRST |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name : | C5orf46 chromosome 5 open reading frame 46 [ Homo sapiens (human) ] |
| Official Symbol : | C5orf46 |
| Synonyms : | AP-64; SSSP1 |
| Gene ID : | 389336 |
| mRNA Refseq : | NM_206966 |
| Protein Refseq : | NP_996849 |
| UniProt ID : | Q6UWT4 |
Products Types
| ◆ Recombinant Protein | ||
| C5orf46-0096H | Recombinant Human C5orf46 Protein, GST-Tagged | +Inquiry |
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
