Recombinant Human C5orf46 protein, GST-tagged
Cat.No. : | C5orf46-301343H |
Product Overview : | Recombinant Human C5orf46 (24-72 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asp24-Thr72 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | DDKPDKPDDKPDDSGKDPKPDFPKFLSLLGTEIIENAVEFILRSMSRST |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | C5orf46 chromosome 5 open reading frame 46 [ Homo sapiens (human) ] |
Official Symbol | C5orf46 |
Synonyms | AP-64; SSSP1 |
Gene ID | 389336 |
mRNA Refseq | NM_206966 |
Protein Refseq | NP_996849 |
UniProt ID | Q6UWT4 |
◆ Recombinant Proteins | ||
C5orf46-0096H | Recombinant Human C5orf46 Protein, GST-Tagged | +Inquiry |
C5orf46-301343H | Recombinant Human C5orf46 protein, GST-tagged | +Inquiry |
C5orf46-2676HF | Recombinant Full Length Human C5orf46 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C5orf46 Products
Required fields are marked with *
My Review for All C5orf46 Products
Required fields are marked with *