Recombinant Full Length Human C5orf60 Protein
| Cat.No. : | C5orf60-3906HF |
| Product Overview : | Human C5orf60 full-length ORF (ADR83448.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 328 amino acids |
| Description : | C5orf60 (Chromosome 5 Open Reading Frame 60) is a Protein Coding gene. |
| Form : | Liquid |
| Molecular Mass : | 11.5 kDa |
| AA Sequence : | MPSSVPKTSVESLGSPSSLSSSKPREPLCPLKHPSHQPPASTLSPNPTSSTESLGETPHAGRWRQGSRFPQPGCANAAGRIRHQNPRHSHGHRISDIHEQLGIS |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | C5orf60 chromosome 5 open reading frame 60 [ Homo sapiens (human) ] |
| Official Symbol | C5orf60 |
| Synonyms | LOC285679; C5orf60; chromosome 5 open reading frame 60; putative uncharacterized protein FLJ35723 |
| Gene ID | 285679 |
| mRNA Refseq | NM_001142306 |
| Protein Refseq | NP_001135778 |
| UniProt ID | A6NFR6 |
| ◆ Recombinant Proteins | ||
| RFL10320HF | Recombinant Full Length Human Putative Uncharacterized Protein C5Orf60(C5Orf60) Protein, His-Tagged | +Inquiry |
| C5orf60-3906HF | Recombinant Full Length Human C5orf60 Protein | +Inquiry |
| C5orf60-5247H | Recombinant Human C5orf60 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C5orf60 Products
Required fields are marked with *
My Review for All C5orf60 Products
Required fields are marked with *
Recently Viewed
