Recombinant Full Length Human C8orf34 Protein, GST-tagged

Cat.No. : C8orf34-2638HF
Product Overview : Human C8orf34 full-length ORF (NP_443190.1, 1 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 427 amino acids
Description : This gene encodes a protein that is related to the cyclic AMP dependent protein kinase regulators. Naturally occurring mutations in this gene are associated with an increased risk for severe toxicities, such as diarrhea and neutropenia, in patients undergoing chemotherapeutic treatment. [provided by RefSeq, Mar 2017]
Molecular Mass : 74 kDa
AA Sequence : MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESKGTRRDFRSYDKPWQLNAKKPKKSKSDLAVSNISPPSPDSKSLPRSVEHPKWNWRTKPQSRDFDELNHILQESKKLGKALENLSRSIAISDELDKETVTFNSSLLRPRVIGEWIGREENDADPLAAEMLQPPIPRSKNDQWESEDSGSSPAGSLKMEPKNKGLKQQQQQHKKLLAAMLSQDSFESIHSPTPSVTEEDIDNEDDAMELLEDLNDLRMEGVTTLVPSGSKFNQGRPTYPAEPQAKVTLNICSRCARLQGDNLEERTEESLPILHSPDEKIPDSFDSLPGTEEALMEEGDEFEKASKLTGPGEASSGVGHSLKNYMEEDESLKQLQVVHQPWILPSDTESEGVEAEQEKRSADLLLCVPCSSCPTLVYSGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C8orf34 chromosome 8 open reading frame 34 [ Homo sapiens ]
Official Symbol C8orf34
Synonyms C8ORF34; chromosome 8 open reading frame 34; uncharacterized protein C8orf34; vest 1; VEST1; vestibule 1; protein VEST-1; vestibule-1 protein; VEST-1; FLJ36872; FLJ37331; DKFZp547E186;
Gene ID 116328
mRNA Refseq NM_001195639
Protein Refseq NP_001182568
UniProt ID Q49A92

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C8orf34 Products

Required fields are marked with *

My Review for All C8orf34 Products

Required fields are marked with *

0
cart-icon