Recombinant Full Length Human C8orf37 Protein, GST-tagged
Cat.No. : | C8orf37-2640HF |
Product Overview : | Human C8orf37 full-length ORF (NP_808880.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 207 amino acids |
Description : | This gene encodes a ubiquitously expressed protein of unknown function. It has high levels of mRNA expression in the brain, heart, and retina and the protein co-localizes with polyglutamylated tubulin at the base of the primary cilium in human retinal pigment epithelial cells. Mutations in this gene have been associated with autosomal recessive cone-rod dystrophy (arCRD) and retinitis pigmentosa (arRP). [provided by RefSeq, Mar 2012] |
Molecular Mass : | 49.8 kDa |
AA Sequence : | MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINEILEEPNLDKKPSKLKSKSSGNTSVRASIEGLGKSCSPVYLGGSSIPCGIGTNISWRACDHLRCIACDFLVVSYDDYMWDKSCDYLFFRNNMPEFHKLKAKLIKKKGTRAYACQCSWRTIEEVTDLQTDHQLRWVCGKH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C8orf37 chromosome 8 open reading frame 37 [ Homo sapiens (human) ] |
Official Symbol | C8orf37 |
Synonyms | C8orf37; chromosome 8 open reading frame 37; RP64; BBS21; CORD16; smalltalk; protein C8orf37; Chromosome 8 Open Reading Frame 37; Smalltalk; Protein C8orf37; CORD16; BBS21; RP64 |
Gene ID | 157657 |
mRNA Refseq | NM_177965 |
Protein Refseq | NP_808880 |
MIM | 614477 |
UniProt ID | Q96NL8 |
◆ Recombinant Proteins | ||
C8orf37-2640HF | Recombinant Full Length Human C8orf37 Protein, GST-tagged | +Inquiry |
C8orf37-0161H | Recombinant Human C8orf37 Protein, GST-Tagged | +Inquiry |
C8orf37-2042H | Recombinant Human C8orf37 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C8orf37 Products
Required fields are marked with *
My Review for All C8orf37 Products
Required fields are marked with *
0
Inquiry Basket