Recombinant Full Length Human C9orf163 Protein, GST-tagged
Cat.No. : | C9orf163-2693HF |
Product Overview : | Human C9orf163 full-length ORF (NP_689784.1, 1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 203 amino acids |
Description : | C9orf163 (Chromosome 9 Open Reading Frame 163) is a Protein Coding gene. |
Molecular Mass : | 48.6 kDa |
AA Sequence : | MPGPLTCTPAWQGQGRAAAFLCCSFQRAGAVVGVPARWHRGRLSSQQRLRSSLGGSHPCPQLGRRLVREGVISVPRQQGRRRCRESFSPADVAPGPICSANICLSGVRFLTCLNRVREHVVGPSPSPAAPICFFPVVEALCTLRGRRCHCLPFPKRGMQRWMLPLRRGARLLPLASSKNPRARSPGLDPLGSSETLWSHRGGH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C9orf163 chromosome 9 open reading frame 163 [ Homo sapiens ] |
Official Symbol | C9orf163 |
Synonyms | RP11-413M3.11 |
Gene ID | 158055 |
mRNA Refseq | NM_152571 |
Protein Refseq | NP_689784 |
UniProt ID | Q96NJ1 |
◆ Recombinant Proteins | ||
C9orf163-2693HF | Recombinant Full Length Human C9orf163 Protein, GST-tagged | +Inquiry |
C9orf163-0191H | Recombinant Human C9orf163 Protein, GST-Tagged | +Inquiry |
C9orf163-2040H | Recombinant Human C9orf163 Protein, His-tagged | +Inquiry |
C9ORF163-1070H | Recombinant Human C9ORF163 Protein (1-203 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C9orf163-140HCL | Recombinant Human C9orf163 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C9orf163 Products
Required fields are marked with *
My Review for All C9orf163 Products
Required fields are marked with *