Recombinant Full Length Human C9orf163 Protein, GST-tagged

• Cat.No.: C9orf163-2693HF
• Product Overview: Human C9orf163 full-length ORF (NP_689784.1, 1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 203 amino acids
• Description: C9orf163 (Chromosome 9 Open Reading Frame 163) is a Protein Coding gene.
• Molecular Mass: 48.6 kDa
• AA Sequence: MPGPLTCTPAWQGQGRAAAFLCCSFQRAGAVVGVPARWHRGRLSSQQRLRSSLGGSHPCPQLGRRLVREGVISVPRQQGRRRCRESFSPADVAPGPICSANICLSGVRFLTCLNRVREHVVGPSPSPAAPICFFPVVEALCTLRGRRCHCLPFPKRGMQRWMLPLRRGARLLPLASSKNPRARSPGLDPLGSSETLWSHRGGH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C9orf163 chromosome 9 open reading frame 163 [ Homo sapiens ]
• Official Symbol: C9orf163
• Synonyms: RP11-413M3.11
• Gene ID: 158055
• mRNA Refseq: NM_152571
• Protein Refseq: NP_689784
• UniProt ID: Q96NJ1